PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn163021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 634aa    MW: 68692.7 Da    PI: 6.5666
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn163021genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.62.8e-28202255155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQk+Rl
  Achn163021 202 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKFRL 255
                 79*******************.********************************8 PP

2Response_reg76.31.2e-25191271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+ + +++l+q+l++  y +v+++++++ a++ll+e++  +D++l D+ mp+mdG++ll+     e++lp+i+++a g  + + + ++ Ga 
    Achn163021  19 VLVVDDDITCLRILEQMLRRCMY-RVTTCSQATVAMNLLRERKgcFDVVLSDVHMPDMDGFKLLELVGL-EMDLPVIMMSADGRTSAVMRGIRHGAC 113
                   89*********************.****************************************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel +
    Achn163021 114 DYLIKPIREEELKN 127
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.04E-3515145IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.8E-4216154No hitNo description
SMARTSM004481.0E-2917129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.56718133IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2219127IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.02E-2720132No hitNo description
PROSITE profilePS5129410.815199261IPR017930Myb domain
SuperFamilySSF466892.15E-19199259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-29200260IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-24202255IPR006447Myb domain, plants
PfamPF002499.0E-7204253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MACKADLVVS DQFPTGLRVL VVDDDITCLR ILEQMLRRCM YRVTTCSQAT VAMNLLRERK  60
GCFDVVLSDV HMPDMDGFKL LELVGLEMDL PVIMMSADGR TSAVMRGIRH GACDYLIKPI  120
REEELKNIWQ HVVRKKWNEN KEQEHSGSLD DNDQHKRGSD DVEYDFSATE GAEELLITQK  180
RRRDAKEENE ELENDDSGTA KKPRVVWSVE LHQQFVSAVN QLGIDKAVPK RILELMNVPG  240
LTRENVASHL QKFRLYLRRL SGVAQQQGGF PNSYCGPVEQ NAKAGTLGRF DIQALAASGQ  300
IPPQTLAALQ AELLGQPTGS RALTGMDQPL LQASLLGTKS IPVDHGVTYG QPLMRCPSNI  360
SKQFPQTVLT VEDVHSGLGV WPSNDLGVVG ASSNLGGLGA QSGNILMGML PQHQHPCQQQ  420
QQQLKQSIVP EPSRSINVQP SCLVVASQSS ASFQSGKSPA SVNQNSFSKG CVIDYRHLSP  480
QSNNSSVVAG LLSDGDVRRT SVLNGCGGPG SISPSVSSCS INADSSAGRH FSGVSPNISG  540
VQGSYCSTSG QLLDQVPLRN LGFVGKGISI PSRFAVDEPG SPTSNLNCGK IYGERNGNKV  600
KQEPRMDFVE NVKVDIPILQ NFSANDLTSV FSE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22201261464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651276.10.0PREDICTED: two-component response regulator ARR1 isoform X1
SwissprotA2XE311e-164ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S71e-164ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLF6HFD20.0F6HFD2_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g05830.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77492130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-123response regulator 2